Apps To Fusion

.......Our Journey from Apps To Fusion

 
  • Increase font size
  • Default font size
  • Decrease font size
We have launched several Development, Functional and DBA Trainings. Visiti http://focusthread.com/training

OA Framework Tutorials Training

Please find a list of OA Framework & Java [in APPS] related articles.

OA Framework Related

 

Get Started with OA Framework

Installing jDeveloper on your PC to get Started with OA Framework Development [11.5.10 CU4]

OA Framework Tutorial 1 - Step by Step in Audio Video

OA Framework Tutorial 2 - Step by Step in Audio Video

OA Framework Training Tutorial 3 - Add record functionality to the screen

OA Framework Training Tutorial 4 - Update record functionality to the screen [Also includes deployment instructions and source code ]

A step by step example to deploy the Tutorial onto APPS Instance

Important OA Framework API - JDR_UTILS

D2K Form comparison with OA Framework

OA Framework : How to design/build a simple screen that interacts with Database table
jDeveloper steps to build the screen as above
Programming the Controller, ApplicationModule to complete this screen

What is MDS - Meta Data Service in OA Framework


What is SPEL - Explained with Audio Visual Demo

Audio Video Demo - How to Embed a Custom Screen into OA Framework Screen

Contains Video Tutorial for steps to develop custom screen and also the extension steps

Audio Video tutorial to explain how Partial Page Rendering Functionality can be built in OA Framework


Entity Objects :- Where do they fit into our Forms/D2K model

Implement Entity Object using PL/SQL API, in OA Framework

Steps to Extend View Object in OA Framework

Extend Entity Object Substitution [using iProcurement] in OA Framework - An Example

Extend OA Framework to use a WebService[Design]

Captcha Implementation. Step by Step Webservice in OA Framework using java

Steps by Step approach to call a Captcha Webservice from OA Framework

How to Extend a Controller in OA Framework Sceen


Extension of Application Module in OA Framework - Part 1


Extension of Application Module in OA Framework - Part 2


How to use XMLImporter in OA Framework

When to bounce and How to Bounce Apache Server when working on OA Framework

OA Framework page on web


Is extension of Controllers in OA Framework Safe? [Some Pointers]

Different techniques to debug OA Framework [With Audio-Video demo]


Add a field with LOV to OA Framework Page, by using Personalization

How to call OA Framework Page from Oracle Forms and the syntax for passing parameters


How to build Master-Detail screen in OA Framework - Part 1


OA Framework Extensions - A Presentation

A Brief History of OA Framework - Presentation


OA Framework R12 Extension Example


Extend OA Framework in R12



 

Personalizations with Audio-Video Demo

User Level Personalization- For individual user

User Level Personalizations by Admin- Shared Folders

How to move personalizations from one environment to another

 

 


Extensions
Steps to prepare your jDeveloper environment for Extensions


Audio-Video Demo- How to run Oracle Apps pages from jDeveloper - Example iProcurement

 

Enable Personalizations -Why is it important to use Functional Administrator to set Profile Options

 

Defaults in OA Framework - Concepts and practical approach


OA Framework Interview Questions

Add Picklist/Dropdown list field to OAF Screen using extension/Personalization
Testing OAF Extensions after deployment- When to bounce what?
Add Submit Button Programatically - Concept

Sample Code- Add Submit Button Programatically

 

 


Java in Oracle Apps
How to write Java Concurrent Programs in Oracle Apps?

Another usage of Java Concurrent Programs



FAQ on OA Framework
FAQ for Extending View Objects in OA Framework

OA Framework - Develop Page that does not require login - Using GUEST
Hide or change Copyright and Privacy Statement in OA Framework
Creating custom Web ADI Integrators
Embed HTML into OA Framework Page- URL Include and other options
Comments (123)add
...
written by sanjeev sadhwani , January 11, 2007
too good stuffs.. keep up good work.. master.
report abuse
vote down
vote up
Votes: +2
...
written by sanjeev sadhwani , January 11, 2007
too good stuffs.. keep up good work.. master.
report abuse
vote down
vote up
Votes: +0
...
written by pavan , January 19, 2007
hi anil

I have doubt abt entity object, what is exact difference between java EO and pl/sql EO? please clarify my doubt with small example.
thanking you
report abuse
vote down
vote up
Votes: +0
...
written by pavan , January 19, 2007
hi anil

I have doubt abt entity object, what is exact difference between java EO and pl/sql EO? please clarify my doubt with small example.
thanking you
report abuse
vote down
vote up
Votes: +1
...
written by Anil Passi , January 20, 2007
Hi Pavan

Yes, Oracle Apps lets you have EO in Java form or PL/SQL API.
If your EO will use multiple table update/deletes or if there exists an API for re-use then you can use PL/SQL based entity object. An example is whereby you want an entity object to create FND_USER. In this case pl/sql fnd_user_pkg could be used.

Please see article http://oracle.anilpassi.com/pl...mpl-2.html

Cheers,
Anil Passi
report abuse
vote down
vote up
Votes: +0
...
written by Anil Passi , January 20, 2007
Hi Pavan

Yes, Oracle Apps lets you have EO in Java form or PL/SQL API. My personal choice is pl/sql.

I will publish some example to demonstrate that.
Please give me a weeks time,

Cheers,
Anil Passi
report abuse
vote down
vote up
Votes: +0
...
written by Sai Bala , February 26, 2007
Anil,

I stumbled upon this site searching for a workflow customization example, and I have to say this is an awesome site. Thanks a bunch...

Sai
report abuse
vote down
vote up
Votes: +0
...
written by pavankumar , April 17, 2007
Hi anil

1)How to register new selfservice form?
2)Breif introduction about personalization?Give me one example?
report abuse
vote down
vote up
Votes: +0
...
written by Ajay Singh , July 05, 2007
good work
ajay singh
report abuse
vote down
vote up
Votes: -1
...
written by Malini , July 13, 2007
Hi Anil,

Thanks for this fantastic site. I have learnt such a lot on customising and working with OA Framework.

Is it possible to open a new window and display an external link like say http://news.bbc.co.uk from a link within an OA Framework page?

I tried this on one of the tutorials, converted an ietm to a link and put the destination as http://news.bbc.co.uk, and it worked fine when I ran it from JDeveloper.

I am now trying to do something similar, but the destination URL does not get formed correctly, it becomes http://tolkien.uk.tnsofres.com...file_name, file_name is my VO item and I'm currently retrieving the value http://news.bbc.co.uk in there.

Your help will be greatly appreciated.

Kind Regards

Malini
report abuse
vote down
vote up
Votes: +0
...
written by Anil Passi , July 13, 2007
Hi Malini

You can use staticStyledText as shown below


In case you wish to achieve this programatically, then use below approach in controller

import oracle.apps.fnd.framework.webui.beans.* ;
public void processRequest(OAPageContext pageContext, OAWebBean webBean)
{
super.processRequest(pageContext, webBean);
OAStaticStyledTextBean ost = (OAStaticStyledTextBean)webBean.findChildRecursive("item1") ;
ost.setLabel("Click here for my website");
ost.setDestination("http://anilpassi.com");
}

PS: item1 is the item with style staticStyledText.

You may also use Raw text to achieve the desired results. < a rel="nofollow" href="http://news.bbc.co.uk" >http://news.bbc.co.uk< / a >

In case you are modifying the standard page, then use personalization to create new item of type staticStyledText

Thanks,
Anil Passi
report abuse
vote down
vote up
Votes: +0
...
written by Sourav , August 07, 2007
Hi Anil,
First of all thanks for all the articles you have written, you are doing a great job.
i had a query ,how can we change the custom home page of apps, as you must have seen in the custom home page i.e the OA.jsp page the message comes like ,Logged in as "XYZ" where xyz represents the login id of the employee which he entered in the login screen,but i want to replace thet messaage by a message Welcome ABC where ABC is the username fetch from the database.Is it possible if yes then how?
report abuse
vote down
vote up
Votes: +0
...
written by Anil Passi , August 07, 2007
Hi Sourav

First you need to find the fnd_message which is responsible for displayinng this.

APPLICATION_ID MESSAGE_NAME MESSAGE_TEXT
-------------- ------------------------------
231 GLB_ER_LOGGED_USER Logged in as &USERNAME
283 CN_LOGGED_IN_AS Logged In As &USER
510 OKC_REP_USER_PAGE_STAMP Logged In As &USER_NAME

I have shortlisted 3 for you. Howver to be 100% sure, you need to run debug log after setting that to Yes at statement level ,for the site.

Thanks,
Anil Passi
report abuse
vote down
vote up
Votes: +0
...
written by silpa , August 27, 2007
Hi Anil
I have a query about the naming convention for the BC4j packages when we create an OA form...

Thanks & Regards
Silpa
report abuse
vote down
vote up
Votes: +1
...
written by silpa , August 27, 2007
Hi Anil
I have a query about the naming convention for the BC4j packages when we create an OA form...What should be the naming convention?

Thanks & Regards
Silpa
report abuse
vote down
vote up
Votes: +1
...
written by Shoaib , August 31, 2007
Hi Anil,
Its really nice of you to have this site setup. thanks buddy for all the info.
I need a little clarification in regards to SubTabLayout and Table region.

For subTabLayout, the problem comes when the user click on the go for search criteria again, the navigation doesnt get transfered to index 0. I have tried stSelectedIdex property, and my intialindex is set to 0 aswell.

For Table region,i want to pass a value from a table cell to populate another table
(similar to master-detail knid of thing) when user clicks that particular value.

Any suggestion will be highly appreciated.

Regards,
Shoaib.
report abuse
vote down
vote up
Votes: +1
...
written by anil passi fan , September 03, 2007
Hi Anil,

Stupendous job. Its become my hobby going through your posts.
I would like to know if R12 OAF documentation is relased or are we required to use 11.5.10 OAF for R12 as well. Also is there any changes in the 11.5.10 & R12 relase w.r.t OAF.

Thanks
Mohd
report abuse
vote down
vote up
Votes: +1
...
written by krithika_gv , September 03, 2007
Hi Anil,

Thanks for all the time that u r spending sharing ur valuable knowledge.Thanks a lot once again.Got a chance to learn a lot from the very good articles on OA framework on this site.

I have got a requirement and need some pointers that can guide me.
Requirement is changing the color of a button. As i am not familiar with applying css using OAF and i couldnt get much help from OAF dev Guide. Can u plz give me some pointers which guide me in completing my requirement.

Thanks,
Krithika.
report abuse
vote down
vote up
Votes: +0
...
written by Anil Neema , September 21, 2007
Hi Anil,
I want to implement data security in custom pages. This could be done in standard web applications like iSupplier portal by defining the security attributes at the USER and the RESPONSIBILITY level. But when tried on custom pages the same approach doesn`t works.
smilies/cry.gif
Please Help
report abuse
vote down
vote up
Votes: +0
...
written by Radhika , September 28, 2007
Hi,
I am implementing iRecruitment.There is a Requirement in iRecruitment---Client wants interview schedule form to be available in iRecruitment Manager.So i enabled the schedule button near status.But the problem is
1.When we click on the button, again i have to find the applicant name.Is there anyway , so that i can get the applicant name directly in the find screen
2.After scheduling the interview, when i am closing the form, i am getting the home page.But i need to be in the page where i created the schedule button.

Could you please help me by giving the solution for these two points.

Regards
Radhika
report abuse
vote down
vote up
Votes: +0
File upload/Download in OA framework
written by debashis , October 03, 2007
Hi Anil,
i have been following most of ur articles those esp on OAF.truly it had been of great help.Thanks You. smilies/smiley.gif
Can u please help me out in implementing file upload/download in my custom OAF page.
Download:
1. What to write in "File View Attribute".
I have created a table with BLOB data type and my VO attribute column has been mapped to the messageDownload field

The problem is that instead of showing the File name as the "Download" link the whole contents of the file is displayed as a link.



report abuse
vote down
vote up
Votes: +0
...
written by shobhit , October 04, 2007
while deploying the search page to the oracle apps after successful completion of all steps when registering with apps we are getting an error page showing following error
oracle.apps.fnd.framework.OAException: Could not load application module 'xxt.oracle.apps.ak.xxperson.server.xxPersonAM'.
Pls suggest ..

report abuse
vote down
vote up
Votes: +0
clarifications required
written by Swapnil , October 05, 2007
Hi Anil,

First of all thanx for making available such user friendly tutorials especially useful for novice developers...
We were trying to deploy search application in oracle apps 11i(11.5.10.2)
using Jdeveloper9i patch p6012619_11i_GENERIC we are facing the following problems:


1. The deployment guide(anjani pandey) available at ur portal has a differnt file structure mentioned( myproject exits in jdevbin whereas in our case it is located inside jdevhome)

2. well, after executing the script mentioned for import(C:p6012619_11i_GENERICjdevhomejdevmyprojects xxtoracleappsakxxpersonwebuixxPersonMainPG.xml -username apps -password apps -rootdir C:p6012619_11i_GENERICjdevhomejdevmyprojects -dbconnection "(DESCRIPTION=(ADDRESS=(PROTOCOL=tcp)(HOST=192.168.32.66)(PORT=1521))(CONNECT_DATA=(SID=TEST)))"
it does shows import successful but when we try to accesss the page through Oracle apps (after registering, of course)we get following error messages:
(i) oracle.apps.fnd.framework.OAException: Application: FND, Message Name: FND_NO_REGION_DATA. Tokens: REGIONCODE = /apps/oracle/testcomn/java/oracle/apps/ak/xxperson/webui/xxPersonMainPG;
(ii) We even changed the HTML call required in apps but every time it shows similar msgs..

We even bounced the Apache server..

Plz suggest a way out...( Kindly also provide explanation i.e logic of import statement)


report abuse
vote down
vote up
Votes: +0
Grid Arrangement of checkboxes
written by Naveen Sreeramoju , October 05, 2007
Hi Anil,

Working in implementation of irecruitment module. Client wants a requirement as below

A grid arrangement of checkboxes is required to allow candidates to indicate their capacity to work at different times of the day on the different days of the week. This should look like below

Morning Hours Evening Hours Not Available.
Mon
Tue
Wed

There should be check boxes, so that applicant can let us know the exact availability of a day.

Can you throw some ideas on this ... or do we have any standard bean component to get this done..?

Regards,
Naveen S
report abuse
vote down
vote up
Votes: +0
...
written by Anil Passi , October 07, 2007
Hi Naveen

You could try TableLayoutBean/Rowlayout bean.
Each checkbox will go into a cellformat.
For the first column of the header, its cellformat will contain a spacer. You will need to optimize spacer for its horizontal width.

Thanks
Anil Passi

report abuse
vote down
vote up
Votes: +0
Thanks for your advice
written by Naveen Sreeramoju , October 17, 2007
Hi Anil,

Thanks for your ideas .. I have used combination of stacklayout and avancedtable to design the grid.

I have few doubts ..
1. Can we change the layout style of a standard page. The client requirement is to move defaultsinglelayout (Standard Look and feel) to defaultDoubleLayout. This is basically to accomodate space and add custom region to the standard one without having scrollbar.

2. If I have added custom region to standard region ... The controllers for standard and custom region will be different... so .. how to commit my transaction in this senario ??

For eg .. irecruitment module have a train of 4 pages, and i have to add custom region in 3 page of the train... controller for my region will be different .. so how can i commit my transaction...?

3. I have to build a new page which facilitates user to send Bulk emails to job seekers... how can we accomplish email functionality in OAF..

Thanks in advance for all your support..

Regards,
Naveen


report abuse
vote down
vote up
Votes: +0
Reg : Adding Regions in Standard page
written by Naveen Sreeramoju , October 17, 2007
Hi Anil,

I have a quick question ... In your demo we were able to add Flexiblelayout region to standard page and then U have given full path for the stacklayout there.

But when I am trying to add a region .. I am unable to see such options lie (Stacklayout,Flexible layout ... etc). On what basis the options over here will get changed...

Regards,
Naveen S
report abuse
vote down
vote up
Votes: +0
...
written by Anil Passi , October 18, 2007
Hi Naveen

1. Changing from Doublecol to SingleCol, at runtime,
perhaps you could try ((OADefaultDoubleColumnBean)oawebbean).setNumberOfColumns(1);
I haven't tried doing this at my end, hence can't be 100% sure if this is going to work.
2. Nested Controller will be called and within that events generated from train can be captured.
In the nested controller[the one against stacklayout], you can use pageContext.getRootApplicationModule() and then invoke the commit within the root AM.
Additionaly another option, if your custom region is attached to a Custom AM, then you can invoke a commit from custom region
3. Use the code provided in http://scripts4oracle.blogspot...ocate.html for sending mass emails from Oracle EBS
4. Once Flexiblelayout has been created, personalize that item which you have created and withinn that click create to add stacklayout region

Thanks,
Anil Passi
report abuse
vote down
vote up
Votes: +0
calling an exsisting jsp from a new jsp and also passing parameters to that page
written by shobhit , October 18, 2007
you have created a great site for the starters like us.thanks a lot.i need to do some customizatio as per the requirements of the project.for that i need to create a new jsp n call an exsisting jsp in the oracle apps.also i need to pass parameters from my new jsp to the inbuilt jsp of apps so that it can populate values there.how can i do this?pls give some solutions.
report abuse
vote down
vote up
Votes: +0
Catching parameters for an OAF Page
written by Naveen Sreeramoju , October 19, 2007
Hi Anil,

Thanks for all your support ....

I have a doubt as how to catch the parameters for a standard page. I have attached a custom region to standard page and when i am trying to query for a static value it is working fine.
But I couldn't able to trace out the the parameter name which is storing the value. I have tried by enabling diagnostics option too.. but no luck ..

Regards,
Naveen S

report abuse
vote down
vote up
Votes: +0
...
written by Anil Passi , October 20, 2007
Hi Naveen
You can find out the list of all the parameters in a controller, by using a method named pageContext.getParameterNames(). This returns Enumeration type object, using which you can iterate over the list of parameters.

Some pages [for example in Oracle Student System] use Session Variables as well.

To analyse Oracle classes, simply decompile and study them.

Thanks
Anil Passi
report abuse
vote down
vote up
Votes: +0
Can I run a OAF page from Home without having apps installed on my system
written by Run OAF from Home , October 21, 2007
Hi Anil,

Can I run a OAF page from Home without having apps installed on my syatem.
It asks for Responsibility key and application user name and password in the project property.

Please let me know if it is possible

Thanks a lot
Pramil
report abuse
vote down
vote up
Votes: +0
...
written by Anil Passi , October 21, 2007
Hi Pramil

You will require access to APPS Database before you can run the OAF Page

Thanks,
Anil Passi
report abuse
vote down
vote up
Votes: +0
How to retrieve the fully URL
written by Manish Neupane , October 24, 2007

Hi Anil,

I'm a newby in OAF development. Over the past 5 days I've managed to go through the Hello World and couple of other tutorial projects and managed a way to implement a new page for the payroll module. Everything so far has worked out pretty good after migrating the new page from my local development into an actual app server, except for a slight issue with the "setRedirectURL" command.

On the server it gives me an error that a forwarding pages needs to be a JSP or HTML, when in fact that is the case. The only way i've been able to get around this issue is to execute the setRedirectURL with the full URL like ("http://xky.server.com/OA_HTML/payslip_temp/file1.html") when before i was only passing in the relative path ("payslip_temp/file1.html"), as it worked without any issues on the local machine.

I would like to make the first part of the URL dynamic ("http://xky.server.com/" right now it's hard coded and we would have issues once the code is moved to the another environment) so is there a way to reterive it from the pageContext object ? . I've looked at the getCurrentURL, and number of other similar function but none of them seem to return the full URL.

Your input into this would be greatly appreciated .

Thanks

Manish

report abuse
vote down
vote up
Votes: +0
Migration of personalizations
written by Naveen Sreeramoju , October 25, 2007
Hi Anil,

How r u ? Thanks for your inputs.. It was very helpful for me all the time..

1. I have personalized standard pages and added custom region to it.. now how can we migrate them to other instance.
2. When I have compiled project in JDEV, It will create classfiles in myclasses directory which also contains RN and PG files. So, what i am doing is move them to $JAVA_TOP and import the PG / RN. But Do we have to create directory structure in $APPL_TOP and move all PG and RN files there ? Is this a repository where we are saving / is there any other purpose ? ..
3. Is there any way to findout the depended objects on a particular region. For example, I have created custom region and now I want to know what are all pages where I have added this ..
4. Can you thorw some ideas on how to change the standard region style eg : defaultSingle layout to double layout.. I have tried your suggestion ((OADefaultDoubleColumnBean)oawebbean).setNumberOfColumns(1), but i couldn't get any solution for that...


Thanks ,
Naveen S

report abuse
vote down
vote up
Votes: +0
Changes to be done to Copy to cart on iProc
written by Chandramouli K , November 14, 2007
Hi Anil,
I am new to jdev ...
In this application which i am working it requires changing the copy to cart functionality ..in case of any items expired copy to cart gives error message ..and business need is to over ride the error message giving the new item reference picked from a custom table ...this mandatorily need not add new item to cart but new item desc should be put on the screen .
Now I was trying to open the ShoppingHomePG which has already some extensions on it
I ftped the custom folders in the custom path and added to my jdeveloper .
As mentioned i have imported the server.xml and available class,xml files too to the jpr .
But when i tried to run the home page ..its giving message stack .

oracle.apps.fnd.framework.OAException: Could not load application module 'oracle.apps.icx.por.req.server.RequisitionAM'.
at oracle.apps.fnd.framework.webui.OAJSPApplicationRegistry.registerApplicationModule(OAJSPApplicationRegistry.java:279)
at oracle.apps.fnd.framework.webui.OAJSPApplicationRegistry.registerApplicationModule(OAJSPApplicationRegistry.java:7smilies/cool.gif
at oracle.apps.fnd.framework.webui.OAPageBean.preparePage(OAPageBean.java:1177)
at

----
## Detail 0 ##
JBO-30003: The application pool (sea-ax0022.davita.comFINTEST1527oracle.apps.icx.por.req.server.RequisitionAM) failed to checkout an application module due to the following exception:
oracle.jbo.JboException: JBO-29000: Unexpected exception caught: oracle.jbo.CustomClassNotFoundException, msg=JBO-26022: Could not find and load the custom class oracle.apps.icx.por.req.server.RequisitionAMImpl
at oracle.jbo.common.ampool.ApplicationPoolImpl.doCheckout(ApplicationPoolImpl.java:1619)
at oracle.jbo.common.ampool.ApplicationPoolImpl.useApplicationModule(ApplicationPoolImpl.java:2366)
at oracle.jbo.common.ampool.SessionCookieImpl.useApplicationModule(SessionCookieImpl.java:427)
at oracle.jbo.http.HttpSessionCookieImpl.useApplicationModule(HttpSessionCookieImpl.java:214)
at oracle.apps.fnd.framework.webui.OAHttpSessionCookieImpl.useApplicationModule(OAHttpSessionCookieImpl.java:473)
at oracle.jbo.common.ampool.SessionCookieImpl.useApplicationModule(SessionCookieImpl.java:39smilies/cool.gif
at oracle.apps.fnd.framework.webui.OAJSPApplicationRegistry.registerApplicationModule(OAJSPApplicationRegistry.java:20smilies/cool.gif
at oracle.apps.fnd.framework.webui.OAJSPApplicationRegistry.registerApplicationModule(OAJSPApplicationRegistry.java:7smilies/cool.gif
at oracle.apps.fnd.framework.webui.OAPageBean.preparePage(OAPageBean.java:1177)
at oracle.apps.fnd.framework.webui.OAPageBean.preparePage(OAPageBean.java:502)
at oracle.apps.fnd.framework.webui.OAPageBean.preparePage(OAPageBean.java:423)
at _OA._jspService(OA.jsp:40)
at com.orionserver.http.OrionHttpJspPage.service(OrionHttpJspPage.java:56)
at oracle.jsp.runtimev2.JspPageTable.service(JspPageTable.java:317)
at oracle.jsp.runtimev2.JspServlet.internalService(JspServlet.java:465)
at oracle.jsp.runtimev2.JspServlet.service(JspServlet.java:379)
at javax.servlet.http.HttpServlet.service(HttpServlet.java:853)
at com.evermind.server.http.ServletRequestDispatcher.invoke(ServletRequestDispatcher.java:727)
at com.evermind.server.http.ServletRequestDispatcher.forwardInternal(ServletRequestDispatcher.java:306)
at com.evermind.server.http.HttpRequestHandler.processRequest(HttpRequestHandler.java:767)
at com.evermind.server.http.HttpRequestHandler.run(HttpRequestHandler.java:259)
at com.evermind.server.http.HttpRequestHandler.run(HttpRequestHandler.java:106)
at EDU.oswego.cs.dl.util.concurrent.PooledExecutor$Worker.run(PooledExecutor.java:803)
at java.lang.Thread.run(Thread.java:534)


How should i go ahead ..please help .

Regards,
Chandramouli
report abuse
vote down
vote up
Votes: +0
Bean classes in OA Framework
written by someone , November 16, 2007
I have found out that OADefaultSingleColumnBean is deprecated and its alternative is OAMessageComponentLayout. So there is a method in OADefaultSingleColumnBean called setHeaderDisabled() but its equivalent is not there in OAMessageComponentLayoutBean. i need that method. Please help me .Thank you
report abuse
vote down
vote up
Votes: +0
what are the table and column changes in interface tables in finance modules
written by rajesh.s , November 16, 2007
Hi,

what are the table and column changes in interface tables in finance modules.

Thanks in advance for ur response.

Thanks
Rajesh
report abuse
vote down
vote up
Votes: +0
Hi Anil,
written by sarathb , December 05, 2007
Hi Anil,

I am working as Oracle apps techincal cosultant,i started learning OA frame work.
I went through your tutorial,its helping me alot.I got an error while developing page i got the following error Error(13,smilies/cool.gif: class xxt.oracle.apps.per.xxperson.schema.server.xxPersonEOImpl should be declared abstract; it does not define method setLastUpdatedBy(oracle.jbo.domain.Number) in class oracle.apps.fnd.framework.server.OAEntityImpl

colud u tell me why this error came.
can i download this tutorial? how can i download please let me know.

Thanks,
Sarath
report abuse
vote down
vote up
Votes: +0
OA Framework and HTML DB
written by amey , December 14, 2007
hi Anil,
Please can you provide highlights on "HTML DB and OA framework comparison"
basically
1) when one should use OA Framework -- is it only related to Oracle apps extension or any general project?
2) For any general project, is HTML DB is better or OA Framework ?
report abuse
vote down
vote up
Votes: +0
Open URL in new window
written by MKONDA , December 17, 2007
Hi Anil,

Thanks for this great site.

Is it possible to open a new window and display an external link like say http://www.oracle.com from a link within an OA Framework page?

I created a new item of type Static Styled Text but the url opens up in the same window. I am trying to add a link to another page.

Thanks for your help.

MKONDA



report abuse
vote down
vote up
Votes: +0
Open URL in new window
written by MKONDA , December 18, 2007
Used this as the destination URI to open a new window.
[removed]void window.open('http://www.oracle.com')

Thanks
MKONDA
report abuse
vote down
vote up
Votes: +0
...
written by sumo , February 06, 2008
Hi Anil,
Why didn't you give us a trainig on creating a tree.
Pls give a training on it.
report abuse
vote down
vote up
Votes: +0
On Line Training
written by Vijay A , February 06, 2008
Anil, Can you offer Weekend online OA Framework Training. we are highly motivated and dedicated 4 members interested to learn on lIne via skype etc.
We are at Houston Tx
please reply.

-Vijay
report abuse
vote down
vote up
Votes: +0
Method createWebBean(oracle.apps.fnd.framework.webui.OAPageContext, java.lang.String) in class oracle.apps.fnd.framework.webui.OAControllerImpl has been deprecated
written by alok , February 12, 2008
Hi! Anil,
Thanks for all information you have posted on your website.
Could you pleas provide correct method to use with example?

- Alok.
report abuse
vote down
vote up
Votes: +0
...
written by Anil Passii , February 12, 2008
Hey Alok

OLD METHOD
-------------
createWebBean(OAPageContext pageContext, String style)


NEW METHOD
-------------
createWebBean(OAPageContext pageContext, String style, String dataType, String itemName)


Having said so, even Oracle's FND internal classes continue to use old creaeWebBean, feel free to decompile and check those out.
There are over 200 instances where oracle haven't migrated their code to new API [as per 11.5.10CU6]


Thanks
Anil
report abuse
vote down
vote up
Votes: +0
Opening a standard oracle form with parameters from OAF page
written by raja anu , February 13, 2008
Hi anil.
Thanks for this great site and the help you are providing.

we have a small problem while calling a standard oracle form from OAF page.

we tried to open the menu form using the following syntax.

form:SYSADMIN:SYSTEM_ADMINISTRATOR:STANDARD:FND_FNDSCAU S

Its opening successfully, but when we are trying to pass some values to
Menu & User Menu name fields, with the following syntax and values

form:SYSADMIN:SYSTEM_ADMINISTRATOR:STANDARD:FND_FNDSCAU S:G_QUERY_FIND=FALSE FND_MENUS.MENU_NAME=SAMPLE_OAF_TEST FND_MENUS.USER_MENU_NAME=SAMPLE_OAF_TEST

it is erroring out like
UTIL-BAD MENU PARAM(NAME=FND MENUS.MENU_NAME) (VALUE=SAMPLE_OAF_TEST)

can you please help us in calling oracle form from the OAF pages by passing values to the form.
Thanks
raja

report abuse
vote down
vote up
Votes: +0
Opening a standard oracle form with parameters from OAF page
written by ram raju , February 15, 2008
Hi anil,

Can you please reply to the above query(Opening a standard oracle form with parameters from OAF page)

It's very important for us to resolve this as early as possible.

Thanks
Ram.
report abuse
vote down
vote up
Votes: +0
...
written by Anil Passi , February 15, 2008
Hi Ram

I have'nt done this in past.

However, I notice there is a java class named RunFunction
This class has a method named getRunFunctionLink to which you can pass in responsibility, Function as parameters.

Once you get the URL, you can assign this value to a link bean.

You can also consider invoking oapagecontext.runFunctionURLRedirect(linkStringFromPrevFunction)
I am yet to use this myself, hence you can use this suggestion to initiate your investigations.


Cheers
Anil
report abuse
vote down
vote up
Votes: +0
Radio Button
written by Paramita Sanyal , February 21, 2008
Hi Anil,

I would like to know how to implement radio button in a page. Could you please help me regarding this?

Thank you,
Paramita
report abuse
vote down
vote up
Votes: +0
Problem in configuring JDeveloper
written by Baskar , March 10, 2008
Hi Anil,
I'm very new to OFA, im trying to configure JDeveloper as per the details given in your tutorial. But receiving "Io exception: The Network Adapter could not establish the connection". Not knowing how to resolve this problem. Using Vision instance in my system and JDK not installed.

Pls tell some solution how to come out from this problem

Thanks
Baskar
report abuse
vote down
vote up
Votes: +0
Please Help: I need a tutorial for How to an attachment region to a page using OAF ?
written by Mahmoud Assem , March 13, 2008
Dear All,
Please can anyone provide me with a tutorial of adding an attachment region and how to view it.

Thanks,
Mahmoud Assem
report abuse
vote down
vote up
Votes: +0
what a wonderful stuff i have never seen this kind of stuff on web
written by sai krishna aravapalli , March 16, 2008
Sir to my knowledge ur the genius who are intendending to help new ones on oracle applications
this work would be really appreciated
report abuse
vote down
vote up
Votes: +1
OIE.K customization
written by Manav Manocha , March 16, 2008
Hi Sir,
i need your advice on one issue i have to work on
Here's the detail
In OIE.K, when a delegate tries to enter an expense report for an employee following error message pops up "Approver: The specified approver is not defined as a user of the application. Please enter another approver, or select one from the list of values." This occurs when the supervisor of an employee for whom expense report is entered either has an end dated User Record in Oracle or does not exists as an Oracle User (they are only entered as an employee). The Oracle standard functionality is to classify this as an invalid approver.
The request is to research and apply a customization to bypass this validation and proceed with the expense report entry even though the supervisor is not a valid supervisor.

This is related to OA framework jdeveloper
Can you please advice as to how i should proceed .i'll be really greatful to you
Thanks
Manav
report abuse
vote down
vote up
Votes: +0
...
written by Anil Passi , March 16, 2008
Hi Manav

Usually, we must not bypass such validations.
This validation is there for a good reason.
If your approver does not have an FND_USER account, then how will they ever Approve the expense report.
How will the workflow send them notifications, as they do not have access to application to logon.


What you should be looking to do is to create default FND_USER accounts for all the employees.
All this can be quite easily scripted.

Anyway, in answer to your question, you can extend view object oracle.apps.ap.oie.server.ApproversVO
When you extend the view object, you need to override the method below

ORIGINAL METHOD
------------------
public OAException validateUserAccount(Number number)
{
boolean flag = true;
flag = hasValidFNDUserAndWfAccount(number);
if(!flag)
return new OAException("SQLAP", "OIE_ENTRY_APPROVER_NOT_USER");
else
return null;
}


METHOD IN EXTENDED VO
------------------
public OAException validateUserAccount(Number number)
{
//do not call super.validateUserAccount(number) ;
return null;
}


Anyway, I hope you convince your business analysts to not to proceed with this extension.


Thanks,
Anil Passi
report abuse
vote down
vote up
Votes: +0
Iprocurement Non-catalog
written by Usha Ananthakrishnan , March 17, 2008
Sir,
I need your help to solve the following issue .
The issue is:
I have entered the Amount(25.00) in Non-catalog request in IProcurement the item type is "Goods or services billed by amount" and I filled the required field then click "Add to Cart button" we can see the shopping cart detail on left side. When we click the "view cart and checkout button" we will see the "amount(25.00)" in "Quantity" field.Price is 1.00 USD but the Amount will display in "Price" field. Amount is misplaced in quantity field. How can I resolve this problem. Please guide me?

Regards,
Usha Ananthakrishnan.
Technical Developer.

report abuse
vote down
vote up
Votes: +0
...
written by Anil Passi , March 17, 2008
Hi Usha,

Sounds like you are facing issue on standard iProc functionality,
Hence please raise SR via metalink

Thanks
Anil
report abuse
vote down
vote up
Votes: +0
SelfSecured Page giving Mac Validation error
written by adv , March 19, 2008
Hi Anil,

we have created an SelfSecured OAF page. this page when loaded on server will work if profile:fnd function validation level =none but when we change this profile option to 'Error' it is not working. where as we have few other SelfSecured pages(log is given below) which are working fine for profile value 'Error'. in Production we are not suppose to change the value to None. so can you please suggest us what could be the issue. below are the log files of our solution and other solution(which is working fine).
Our solution:

[437]:STATEMENT:[fnd.framework.webui.OAPageSecurity]smilies/tongue.gifage Securing Expression = ${oa.FunctionSecurity.XXAT_POACCL_GUEST_FUNC}
[437]:STATEMENT:[fnd.framework.webui.OAPageSecurity]:Current Page SelfSecured = true
[437]:STATEMENT:[fnd.framework.webui.OAPageSecurity]:Current Page matea data securing function = XXAT_POACCL_GUEST_FUNC
[437]smilies/tongue.gifROCEDURE:[fnd.common.WebAppsContext]smilies/shocked.gifracle.apps.fnd.common.WebAppsContext.getFNDGlobal(): BEGIN
[437]smilies/tongue.gifROCEDURE:[fnd.common.WebAppsContext]smilies/shocked.gifracle.apps.fnd.common.WebAppsContext.getFNDGlobal(): END
[437]smilies/tongue.gifROCEDURE:[fnd.common.WebAppsContext]smilies/shocked.gifracle.apps.fnd.common.WebAppsContext.getFNDGlobal(): BEGIN
[437]smilies/tongue.gifROCEDURE:[fnd.common.WebAppsContext]smilies/shocked.gifracle.apps.fnd.common.WebAppsContext.getFNDGlobal(): END
[437]smilies/tongue.gifROCEDURE:[fnd.common.WebAppsContext]smilies/shocked.gifracle.apps.fnd.common.WebAppsContext.getFNDGlobal(): BEGIN
[437]smilies/tongue.gifROCEDURE:[fnd.common.WebAppsContext]smilies/shocked.gifracle.apps.fnd.common.WebAppsContext.getFNDGlobal(): END
[437]:STATEMENT:[fnd.framework.webui.OAPageSecurity]:MAC validation status = false
[437]:STATEMENT:[fnd.framework.webui.OAPageSecurity]:Request parameters validation status = false
[437]:STATEMENT:[fnd.framework.webui.OAPageSecurity]:Security Level = ERROR
[438]:STATEMENT:[fnd.framework.webui.OAPageSecurity]smilies/tongue.gifage Securing function = XXAT_POACCL_GUEST_FUNC

Other Solution:
[40]:STATEMENT:[fnd.framework.webui.OAPageSecurity]:Security Level = ERROR
[40]:STATEMENT:[fnd.framework.webui.OAPageSecurity]:Current Page SelfSecured = false
[40]:STATEMENT:[fnd.framework.webui.OAPageSecurity]:Current Page matea data securing function = null
[40]smilies/tongue.gifROCEDURE:[fnd.common.WebAppsContext]smilies/shocked.gifracle.apps.fnd.common.WebAppsContext.getFNDGlobal(): BEGIN
[40]smilies/tongue.gifROCEDURE:[fnd.common.WebAppsContext]smilies/shocked.gifracle.apps.fnd.common.WebAppsContext.getFNDGlobal(): END
[40]smilies/tongue.gifROCEDURE:[fnd.common.WebAppsContext]smilies/shocked.gifracle.apps.fnd.common.WebAppsContext.getFNDGlobal(): BEGIN
[40]smilies/tongue.gifROCEDURE:[fnd.common.WebAppsContext]smilies/shocked.gifracle.apps.fnd.common.WebAppsContext.getFNDGlobal(): END
[40]smilies/tongue.gifROCEDURE:[fnd.common.WebAppsContext]smilies/shocked.gifracle.apps.fnd.common.WebAppsContext.getFNDGlobal(): BEGIN
[40]smilies/tongue.gifROCEDURE:[fnd.common.WebAppsContext]smilies/shocked.gifracle.apps.fnd.common.WebAppsContext.getFNDGlobal(): END
[41]:STATEMENT:[fnd.framework.webui.OAPageSecurity]:MAC validation status = true
[41]:STATEMENT:[fnd.framework.webui.OAPageSecurity]:Request parameters validation status = false
[41]:STATEMENT:[fnd.framework.webui.OAPageSecurity]smilies/tongue.gifage Securing function = null

Thanks,

Advait...
report abuse
vote down
vote up
Votes: +0
Attachments
written by Ashwini , March 24, 2008
Hi Anil,

I am learning OAF from past 4 months.
I came across the topic of Attachments in OAF.
Can you please provide some information on that.

Thanks in Advance
report abuse
vote down
vote up
Votes: +0
...
written by Pramod Bellamkonda , April 04, 2008
Hi

When I try to Create New Person from your tutorial. First the ManagePersonPG do not show up. GIVES some application id error.

Solved it by giving the path

/xxt/oracle/apps/ak/xxperson/webui/managePersonPG" ---"There was no XXT in your path"


But now when i click "Create New Person" it goes to "ManagePersonPG" but the last record in the table is AUTOMATICALLY POPULATED in the ManagePersonPG Page ?

Is it Some buffer problem, why it is retaining the last record?
report abuse
vote down
vote up
Votes: +1
...
written by Pramod Bellamkonda , April 04, 2008
Hi Anil

where exactly we need to initialize Vo sothat it points to New record in memory.?

where exactly we need to initialize Vo sothat it points to New record in memory?
report abuse
vote down
vote up
Votes: +2
Beginner in OAF
written by Ashwini , April 22, 2008
Hi Anil...

Please guide on how to call a Oracle Form from a OAF screen. You have shown Oracle Form calling OAF page but will vice versa take place?

And also let me know how tough is to start with Jdeveloper 10g. I had worked for 2-3 months on Jdeveloper9.0.3 version.

Please guide me on what all I need to look into this tutorial as a beginner.

Thanks
Ashwini.
report abuse
vote down
vote up
Votes: +0
Run iSupplier Portal page through local machine (urgent)
written by AMIT , April 23, 2008
Hi Anil,
I have to extend few page of iSupplier Portal. I am really trying hard to run the page from my local machine. I have gone through your article on how to setup JDeveloper to run page local.
I have got confusion. You have mentioned about step10. Include all available libraries into jDeveloper project.

What exactly libraries are you talking about?
How can i add any ****PG.xml file which i found using personalization link in project?
Can I just open xml file using open under file menu to include into OAProject?

What is the Import option available under file menu? I am able to use this only for server.xml file.
There is one more option available "Copy files to project Directory". I could not find any help regrading this.

I am completely stuck at xml file which i have downloaded from mds directory..
please guide me how to run any page which we download from mds. I have seen your video to setup jdev to run page on local machine.
There 10gJdeveloper has automatically included all the files under project. I am currently using 9iJDeveloper for 11i10 RUP5. This does not include file automatically.

I can send you screen shot of all steps which i have done. Please help me on this. Its really urgent.

thanks
Amit
report abuse
vote down
vote up
Votes: +1
Extend VO
written by kishore Ryali , April 27, 2008
Reference Link: http://oracle.anilpassi.com/ex...mwork.html

During VO extension, after creation of new view attributes for task_num, award_num etc. you entered the query based on new view xxicx_pa_projects_expend_v.
Does that mean if during patching original view pa_projects_expend_v changes, those upgrades are not propogated to the extended VO.
So is it not breaking the sanity of going for safe VO extensions?

Regards
Kishore Ryali
report abuse
vote down
vote up
Votes: +0
VO's in expert mode
written by Anil Passi- , April 28, 2008
Hi Kishore

You are right, for VO's that are created in expert mode in Oracle, run this risk during the extension.

Thanks,
Anil Passi

report abuse
vote down
vote up
Votes: +0
about OAPageContext.
written by chenlin , April 28, 2008
I just got a question with pageContext.setForwardURL(),I see there is something different between r11 and r12. (I use JDeveloper 10 in R12),But when i followed the sample "OA Framework Training Tutorial 03 " ,i found that the jdeveloper tell me there is an complain error with setForwardURL(),the parameter did not matched!
report abuse
vote down
vote up
Votes: +0
...
written by chenlin , April 28, 2008
When i rebuild the sample i got a error about:
Error(62,25): method setForwardURL(java.lang.String, byte, null, java.util.HashMap, boolean, java.lang.String, byte) not found in interface oracle.apps.fnd.framework.webui.OAPageContext
Who can tell me?
Thanks.
report abuse
vote down
vote up
Votes: +0
...
written by chenlin , April 28, 2008
Thank you ,I have find my answor.
report abuse
vote down
vote up
Votes: +0
There is a BUG in the sample(In OA Framework Tutorials 03)
written by chenlin , April 30, 2008
Hi,I have find a bug in the sample. After i followed the sample(the video),I find that i can not create a new person in "managePersonPG".In fact,i create it in the page,but it no reflect to DB,(I can not get my new person in DB).
And,I already get the why. In the managePersonCO.java file, in the "processFormRequest" method,like:
=============
if ( pageContext.getParameter("savePerson") != null )
{

personam.invokeMethod("savePersonToDatabase") ;

pageContext.setForwardURL(
"OA.jsp?page=/oracle/apps/ak/xxperson/webui/xxPersonMainPG"
, null //not needed as we are retaining menu context
,OAWebBeanConstants.KEEP_MENU_CONTEXT
, null //not needed as we are retaining menu context
,null // no parameters are needed
,true //retain AM
,OAWebBeanConstants.ADD_BREAD_CRUMB_NO
,OAWebBeanConstants.IGNORE_MESSAGES);

}
======================

if I change the "pageContext.getParameter("savePerson") " to " pageContext.getParameter(EVENT_PARAM)", than the problam solved.!!!!
report abuse
vote down
vote up
Votes: -1
Thanks chenlin
written by Anil Passi- , April 30, 2008
Thanks for letting us know
report abuse
vote down
vote up
Votes: +0
...
written by cscus , May 14, 2008
Hi Anil,

How to find WHO column details in a OAF page?

Thanks,
Aryan
report abuse
vote down
vote up
Votes: +1
Need help on JDeveloper 9 download
written by Gopik , May 18, 2008
Hi Anil,

I need Jdev 9i software, but it is not available on the Oracle site, I searched through the net but didn't find it.
Can you pls help me? Where can i download it? Other wise, can i use app11.5.10. 2 with jdev 10? Pls giv give me a suggestion.
Gopi
report abuse
vote down
vote up
Votes: +1
...
written by Anil Passi , May 18, 2008
Hi Gopi

You need to download apps version of jDev from Metalink.
In your case, you need to download patch 4573517 to get the right version of jDeveloper for 11.5.10 CU2

See the metalink note below
---------------------------------------
Subject: How to find the correct version of JDeveloper to use with eBusiness Suite 11i or Release 12
Note:416708.1

Release 11i
OA Framework 5.10 patch JDeveloper 9i Patch
ATG.PF.H (patch 3438354 or Oracle Applications 11.5.10) Patch 4045639 9IJDEVELOPER WITH OA EXTENSION ARU FOR FWK.H
ATG PF CU1 (patch 4017300) Patch 4141787 9IJDEVELOPER WITH OA EXTENSION ARU FOR CU1
ATG PF CU2 (patch 4125550) Patch 4573517 Oracle9i JDeveloper with OA Extension for 11.5.10 CU2
11i.ATG_PF.H RUP3 (patch 4334965) Patch 4725670 9IJDEVELOPER WITH OA EXTENSION ARU FOR 11i10 RUP3
11i.ATG_PF.H RUP4 (patch 4676589) Patch 5455514 9IJDEVELOPER WITH OA EXTENSION ARU FOR 11i10 RUP4
11i.ATG_PF.H RUP5 (patch 547385smilies/cool.gif Patch 6012619 9IJDeveloper With OA Extension ARU FOR 11i10 RUP5

11i.ATG_PF.H.RUP6 (patch 5903765)
Patch 6469392 9IJDEVELOPER WITH OA EXTENSION ARU FOR 11I10 RUP6
Release 12

ATG Release 12 Version
JDeveloper 10g Patch
12.0.0 Patch 5856648 10g Jdev with OA Extension
12.0.1 (patch 5907545) Patch 5856648 10g Jdev with OA Extension
12.0.2 (patch 5484000 or 5917344) Patch 6491398 10g Jdev with OA Extension ARU for R12 RUP2 (replaces 619741smilies/cool.gif
12.0.3 (patch 6141000 or 6077669) Patch 6509325 10g Jdev with OA Extension ARU for R12 RUP3
12.0.4 (patch 6435000 or 6272680) Patch 6908968 10G JDEVELOPER WITH OA EXTENSION ARU FOR R12 RUP4


Thanks,
Anil Passi
report abuse
vote down
vote up
Votes: +1
Thanks for help
written by Gopik , May 19, 2008
Hi Anil,

Nice hearing from you. Now I got the clear picture of Jdev Version and compatibility with Apps.
Thank you very much for your time.

Gopi

report abuse
vote down
vote up
Votes: +0
oracle.jbo.RowCreateException: JBO-25017
written by Cyril PHCAR , May 20, 2008
Hi !

I encounter the following error :

## Detail 0 ##
java.lang.InstantiationException
at sun.reflect.InstantiationExceptionConstructorAccessorImpl. newInstance(InstantiationExceptionConstructorAccessorIm pl.java:30)

Can anybody help me ?

Thanks by advance !

Cyril
(from France)
report abuse
vote down
vote up
Votes: +0
oracle.jbo.RowCreateException: JBO-25017
written by Cyril PHCAR , May 21, 2008
Hi !

I have found the cause : my specific table didn't have Who Columns.

Thanks !

Cyril
report abuse
vote down
vote up
Votes: +1
OA Framework error
written by ShShSar , May 24, 2008
Hi,
I am getting the following error when I was trying to compile the Impl.java files of my EOs,

Error(14,smilies/cool.gif: class xxch.oracle.apps.fnd.schema.server.XXQAEOImpl should be declared abstract; it does not define method setLastUpdatedBy(oracle.jbo.domain.Number) in class oracle.apps.fnd.framework.server.OAEntityImpl

Can you please tell me what I am doing wrong?
report abuse
vote down
vote up
Votes: +0
Problem with EO and VO Creation
written by ShShSar , May 24, 2008
Table UserInfo:
==============
Column NameIDPkNull?Data TypeDefaultHistogramEncryption AlgSalt

USER_PK11NNUMBERNo
USER_NAME2YVARCHAR2 (30 Byte)No
PASSWORD3YVARCHAR2 (16 Byte)No
EMAIL_ID4YVARCHAR2 (60 Byte)No
MOBILE_NUM5YNUMBERNo
CREATED_BY6YNUMBERNo
CREATION_DATE7YDATENo
LAST_UPDATED_BY8YNUMBERNo
LAST_UPDATE_DATE9YDATENo
LAST_UPDATE_LOGIN10YNUMBERNo


Table Questions:
=================
Column NameIDPkNull?Data TypeDefaultHistogramEncryption AlgSalt

QUESTION_ID11NNUMBERNo
QUESTION2YVARCHAR2 (60 Byte)No
CREATED_BY3YNUMBERNo
CREATION_DATE4YDATENo
LAST_UPDATED_BY5YNUMBERNo
LAST_UPDATE_DATE6YDATENo
LAST_UPDATE_LOGIN7YNUMBERNo


Table QA:
==========
Column NameIDPkNull?Data TypeDefaultHistogramEncryption AlgSalt

QA_KEY11NNUMBERNo
USER_PK2NNUMBERNo
QUESTION_ID3YNUMBERNo
ANSWER4YVARCHAR2 (60 Byte)No
CREATED_BY5YNUMBERNo
CREATION_DATE6YDATENo
LAST_UPDATED_BY7YNUMBERNo
LAST_UPDATE_DATE8YDATENo
LAST_UPDATE_LOGIN9YNUMBERNo

Able are the columns in my tables. I am having trouble creating EOs and VOs such that user will enter his userid, pwd, email,mobile and choose all 3 questions and enter answers for them. Thanks in advance.
report abuse
vote down
vote up
Votes: +0
...
written by Anil Passi- , May 25, 2008
HI Shsh

To overcome this issue, simply copy past the below lines into your EOImpl
public void setLastUpdateLogin( oracle.jbo.domain.Number n ) {}
public void setLastUpdatedBy( oracle.jbo.domain.Number n ) {}
public void setLastUpdateDate( oracle.jbo.domain.Date n ) {}
public void setCreationDate( oracle.jbo.domain.Date n ) {}
public void setCreatedBy( oracle.jbo.domain.Number n ) {}

Cheers
Anil
report abuse
vote down
vote up
Votes: +0
...
written by santhosh kumar , June 06, 2008

why Oracle changed direction from Oracle Forms to OA Framework and need of oa framework.plz explain me in detail becz i'm new to oaf


thankinu,
santhosh
report abuse
vote down
vote up
Votes: +0
...
written by Anil Passi , June 06, 2008
Hi Santosh,

It isn't Oracle that changed the direction, the industry itself changed the direction.
However, if you are keen to know the reasons, I request you learn the possibilities of OA Framework extension, and then you will find the answer by yourself.

Thanks,
Anil Passi
report abuse
vote down
vote up
Votes: +0
...
written by Manav , June 06, 2008
HI Anil;

Thanks once again for all your help you have provided to me . I have one more question on Form Personalization. We are on OIE.K and i have a req . from one of client t that they want to SORT credit card transactions in IExpense . I know the steps in order to enable this feature. What i am doing right now is i have assigned my self as a delegate to that user and on Credit Card Transaction page.i am personalizing. However,i want to know is there any way i can personalize this page from any Admin responsibility ,i mean without assigning myself as a delegate to that user and simply personalize (enable sorting order) at site level.

Thanks,
Manav
report abuse
vote down
vote up
Votes: +0
...
written by Anil Passi- , June 06, 2008
Hi Manav


For OA Framework screens, if you wish to personalize without going into that screen, first find the full path of that page using "About this Page". Next you can also use Functional Administrator to personalize that page, by creating seeded user level personalization. There is a video demo for the same on website.


In case yours is a D2k screen, then you will have to go to that screen itself and change the default where clause using personalization.

Thanks,
Anil Passi


report abuse
vote down
vote up
Votes: +0
OA framework : List boxes used to select items - can it be done?
written by Joseph , June 27, 2008
Hi Anil,

I would like to develop a page that has two list boxes. List box A, on the left of the form that contains all valid items, and List box B on the right that will include selected items from list box A. Two buttons will be placed between the list boxes. One will be used to move the selected items from list box A to B. And one to move items from B back to A.

List box A will be loaded with items depending on a text field and a combo box. For example, if text field is period "May-08" and combo box action is "Close", in list box A I want to display those companies that have "May-08" period open in their accounting system.

Is this possible with OA framework? If so, can you please give me some tips on what I should research on?

Many thanks
Joseph
report abuse
vote down
vote up
Votes: +0
OA framework : List boxes used to select items - can it be done?
written by Prabhakar Somanathan , June 27, 2008
OA framework has a inbuilt comopnent called Shuttle that performs your Ui requirement.
It also allows to UI for the search you are looking for.

Please read the developer guide chapeter 4 : Implementing Specific Ui features -- > Shuttle

Hope this helps you.


cheers,
Prabhakar.S
report abuse
vote down
vote up
Votes: +0
getting error while running tutorial.jpr
written by vijay sharma , July 02, 2008
oracle.apps.fnd.framework.OAException: java.sql.SQLException: ORA-01653: unable to extend table ICX.ICX_SESSION_ATTRIBUTES by 16 in tablespace APPS_TS_TX_DATA
ORA-06512: at "APPS.FND_SESSION_MANAGEMENT", line 1367
ORA-06512: at line 1


report abuse
vote down
vote up
Votes: +0
Regarding Insertion of data
written by Rahul Minocha , July 04, 2008
Hi ,

I am having this problem of inserting data simultaneously into multiple tables.....And also the concept of View Link
Can anyone help.....

Thanks
report abuse
vote down
vote up
Votes: +0
...
written by jyo , July 15, 2008
Hi Anil, I tried your tutorial for update person and I encountered a minor issue and would be glad if you could answer this.
When I click in update icon in a row, it takes me to managePersonPG with the correct record to be updated. I enter some details and I click commit data, it takes me to the xxPersonMainPG with the updated record displayed in the query field, where as it should be blank.
I think when the page renders it takes that updated record to be shown in the query field.
what am I missing here ?
Thanks
Jyo
report abuse
vote down
vote up
Votes: +0
diff b/w customization and extension
written by krish , July 23, 2008
Hi Anil,
Thank u for ur guidence.plz clarify my doubt.
can u tell the difference between customization and extensions. plz explain with an simple examples.
both r same?. i didn't find any thing on customization in these tutorials.i need clear idea on customization ie, in which scenerio we go for customization.plz clarify it.

Thanking u,
krish

report abuse
vote down
vote up
Votes: +0
How to set multiple indexes when a Page Renders in Dynamic List Box
written by Shweta Sinha , October 31, 2008
hi,

I am having problem in setting multiple indexes when a Page Renders in Dyanamic List Box.

can anyone help me....

Thanks
Shweta
report abuse
vote down
vote up
Votes: +0
error in opening OA Page
written by Nirmal , December 03, 2008
Hi Anil,
I get the following error when i run the Page.
"http://198.162.100.182:8988/OA_HTML/runregion.jsp
Application Not Found"
What could be wrong. Plz help.
report abuse
vote down
vote up
Votes: +0
Assigning Values to View Attributes
written by A.Malar Selvam , January 29, 2009

Dear Anil,

I am having one problem, kindly guide me how to overcome this.

In a Controller Class ProcessRequest() function i am creating new row and initializing values to some attributes to my views through Application Module Implementation Class as below.

SalesHeadersVOImpl shi = getSalesHeadersVO();
Row r1 = shi.createRow();
r1 = shi.createRow();
r1.setAttribute("SaleOrderHeaderId", headerid);
r1.setNewRowState(Row.STATUS_INITIALIZED);


LinesVOImpl lvo = getLinesVO();
Row r2 = lvo.createRow();
r2 = lvo.createRow();
r2.setAttribute("SaleOrderHeaderId", headerid);
r2.setNewRowState(Row.STATUS_INITIALIZED);

After that I am getting Inputs from the User for the Remaining View Attributes.

Now my problem is while doing getDBTransaction().commit(), i have to assign some values manually to the View Attributes. How can i Achieve this?
Presently I am doing as below, but the values are not committed in the database.


LinesVOImpl lvo = getLinesVO();
SalesHeadersVOImpl shi = getSalesHeadersVO();

shi.setProperty("SaleOrderNumber",getOADBTransaction().getSequenceValue("XXPOS_SALE_ORDER_NUMBER_S"));
lvo.setProperty("SaleOrderNumber", shi.getProperty("SaleOrderNumber"));

getDBTransaction().commit();


But the values are not affecting in the database.

Kindly guide me how to assign values to the View Attributes while doing getDBTransaction().commit().

Regards.

A.Malar Selvam.



report abuse
vote down
vote up
Votes: +0
SE
written by Payal , February 24, 2009
Hi Anil,

I'm new to OA framework and am learning from your articles. I've a requirement in oracle configuration module to go to an external site on a click of a button. The configuration details are entered in that site and stored in an XML string. That site is in asp.
Now, I need to get the control back to oracle configurator page and read the xml string and populate the fields on oracle page from the xml string.

I've personalized the oracle page to navigate to configurator site. I also know how to read xml string and enter the specific values in text fields.
I'm looking for a way to redirect to same oracle page from asp page without asking the user to relogin.
Do you know how can this be achieved?

Thanks,
Payal
report abuse
vote down
vote up
Votes: +1
iprocurement
written by Srini , March 10, 2009
I have a requirement in iproc to make the project field required based on a value in account segments. Appreciate any help in this regard
report abuse
vote down
vote up
Votes: +0
Please send me the next URL.
written by Keerthana , March 31, 2009
Hi Anil,
Please let me know the next-part URL (s)(Vedio and Audio link) which are after the below mentioned URL.
http://anilpassi.com/demo/oa_framework/runPageFromjDev/prepare_environment_etc1/prepare_environment_etc1.html



report abuse
vote down
vote up
Votes: +1
FND, Message Name: SECURITY_INVALID_DBC_PARAMETER
written by Malar Selvam , April 20, 2009
Hi Anil,

I tried to connect with ORacle Apps Release 12.0.4 using JDeveloper 10.3.1. I have created a test page, but i was getting the below error:

oracle.apps.fnd.framework.OAException: Application: FND, Message Name: SECURITY_INVALID_DBC_PARAMETER

Then i found, i have to use Patch 6908968 10G JDEVELOPER WITH OA EXTENSION ARU FOR R12 RUP4. I have downloaded that Patch also.
But, now i am getting 500 Internal Server Error while running my Custom Page.

Then I, just tried to test my Application Module (Empty one not having any View). I am getting the following Error.

JBO-30003: The application pool (.120C3C3AD59) failed to checkout an application module due to the following exception:
oracle.jbo.JboException: JBO-29000: Unexpected exception caught: oracle.jbo.JboException, msg=JBO-29000: Unexpected exception caught: oracle.jbo.JboException, msg=JBO-25222: Unable to create application module.

I tried to run the HelloWorld Sampe Application, that also giving the same problem.

Kindly guide me, how to configure JDeveloper for Release 12.0.4.

Regards.

Malar.

report abuse
vote down
vote up
Votes: +0
Mapping Servlet in R12
written by Malar Selvam , April 30, 2009
Dear Anil,

I have developed some custom pages for R12. In one of the page to read the image i am using one Servlet. I have configured the Servlet path in web.xml located in "jdevhomejdevmyhtmlOA_HTMLWEB-INF" as below
------------------------------

ReadImage
oracle.apps.xxcust.sshrms.CO.ReadImage



ReadImage
/readimage

------------------------------

And it is working fine.

Now i want to deploy the pages into Apps Server. Please let me know,
1) In which file i have to include the Servlet Mapping?
2) In wich TOP the file will be there.
3) And the Path of the File.

Regards.

Malar.
report abuse
vote down
vote up
Votes: +0
Servlet Mapping
written by Malar Selvam , May 05, 2009
Hi Anil,

I found that we have to place servlet mapping in orion-web.xml.

path:
cd $INST_TOP

cd ora/10.1.3/j2ee/oacore/application-deployments/oacore/html/

Servlet Mapping:
------------------------------

ReadImage
oracle.apps.xxcust.sshrms.CO.ReadImage



ReadImage
/readimage

------------------------------

Now it is working fine.

But in some regular interval the service is stopping. After that i need to start the service again and again.

Please guide me how to resolve the issue.

Regards.

Malar.


report abuse
vote down
vote up
Votes: +0
Read Image
written by Malar Selvam , May 17, 2009
Hi Anil,

Regarding Servlet Mapping issue for Reading Image, i got one more solution from one POST. In that instead of separate servlet class they are reading the image column and creating a temporary file as below. It is working fine locally in my JDeveloper, but once deployed into my Linux Server the image is not displaying and also there is no error.

Controller Class:

Serializable[] param = {pageContext.getTemporaryImageLocation()};

pageContext.getApplicationModule(webBean).invokeMethod("initImg",param);
OAImageBean oaimagebean = (OAImageBean)webBean.findIndexedChildRecursive("EmpImg");
if(oaimagebean != null)
{
oaimagebean.setAttributeValue(UIConstants.SOURCE_ATTR, new OADataBoundValueViewObject(oaimagebean, "ImageSource"));
oaimagebean.setWidth(100);
oaimagebean.setHeight(110);
oaimagebean.setBorderWidth(2);
}
if(pageContext.isLoggingEnabled(1))
pageContext.writeDiagnostics(this, "Leaving processRequest..", 1);

----------------
In AM:


public void initImg(String s2)
{
OAViewObjectImpl oaviewobjectimpl = getEmpProfileVO();
oaviewobjectimpl.executeQuery();
if(oaviewobjectimpl.first() != null)
{
OARow oarow = (OARow)oaviewobjectimpl.first();
BlobDomain blobdomain = (BlobDomain)oarow.getAttribute("Image");
if(blobdomain != null)
{
String s3 = createFile(s2, blobdomain, "Emp"+oarow.getAttribute("PersonId").toString());
oarow.setAttribute("ImageSource", s3);
}
}
}



public void fromInputToOutput(InputStream inputstream, OutputStream outputstream) throws IOException
{
byte abyte0[] = new byte[255];
int i = 255;
do
{
if(i != '377')
break;
i = inputstream.read(abyte0);
if(i < 0)
break;
outputstream.write(abyte0, 0, i);
} while(true);
outputstream.close();
inputstream.close();
}

public String createFile(String s, BlobDomain blobdomain, String s1)
{
File file = new File(s);
if(!file.exists())
file.mkdirs();
File file1 = new File(s, s1);
try
{
fromInputToOutput(blobdomain.getBinaryStream(), new FileOutputStream(file1));
}
catch(IOException ioexception)
{
ioexception.printStackTrace();
}
return (new StringBuilder()).append("fwk/t/").append(file1.getName()).toString();
}

-----------------------------------------------

VO:

SELECT
PERSON_ID, EMPLOYEE_NUMBER, EMP_NAME, DOJ, ORG_NAME, POSITION, DIVISION, DEPT, LOCATION,
PAYROLL_ID, CONFIRMATION_DATE, EMAIL_ADDRESS, WORK_TELEPHONE, EMP_TYPE, IMAGE, Null Image_Source
FROM
XXGTI_EMPPRO

---------------------------

Using this solution, i am able to display the image locally running from JDeveloper, but after deployed into our LINUX Server it is not displaying the image.

Can u please guide me.

Regards.

Malar.
report abuse
vote down
vote up
Votes: +0
OA Framework : Jdeveloper database conncetion error
written by Shaswat Kumar , June 17, 2009
Hi Anil,

I was going thru your OA framework tutorial and following step by step.
but While trying to connect to database thru Jdeveloper getting this error.

io exception: connection refused(description=(tmp=)(vsnnum=169870080)(err=12505) (error_stack=(error=(code=12505)(emfi=4))))

Please help.

Thanks
report abuse
vote down
vote up
Votes: +0
...
written by Anil Passi- , June 17, 2009
Try to telnet to that machine on which DB is hosted,

telnet machineNameHere PortNumberHere

Does it connect from your PC?

If not, then you have firewall issues

Thanks
Anil Passi
report abuse
vote down
vote up
Votes: +0
Calling External Application with Parameters
written by Malar Selvam , July 21, 2009
Dear Anil,

I want to call an External Application when clicking a button. For testing I have given "http://www.yahoo.com" and it is working fine.

My Requirement is i would like to call an External Web Application like this. But i need to pass Values from OAF Pages as parameters.

How can we achieve this? Please guide me.

Regards.

Malar.
report abuse
vote down
vote up
Votes: +0
Calling External URL with Parameter
written by Malar Selvam , July 22, 2009
Dear Anil,

When Clicking a button, I want to popup an external URL from my Controller Class. I need to pass some parameters (OAF Page Field Values) dynamically.

Please guide me how to achieve this?

Regards.

Malar.
report abuse
vote down
vote up
Votes: +0
Poup URL from OAF Controller Class
written by Malar Selvam , July 23, 2009
Dear Anil,

We need to popup an OAF Page, for that i put the following code in my ProcessFormRequest function, but it is giving JavaScript Error:Objected Expected.

Kindly guide us to solve the issue.
---------------------
String pubOrderId = param;
StringBuffer l_buffer = new StringBuffer();
StringBuffer l_buffer1 = new StringBuffer();
l_buffer.append("[removed]mywin = openWindow(top, '");
l_buffer1.append("/oracle/apps/xxcust/adec/webui/tempPG");
l_buffer1.append("&retainAM=Y");
l_buffer1.append("¶m="+pubOrderId);
pageContext.putJavaScriptFunction("SomeName",l_buffer.toString());
-------------------

I paste below the javascript dynamically created.

[removed]mywin = openWindow(top, '/OA_HTML/OA.jsp?page=/oracle/apps/xxcust/adec/webui/tempPG&retainAM=Y¶m=233&addBreadCrumb=S&_ti=499301981&oapc=2&oas=dtn4Te15R-JfH2bTwjbOcQ..', 'lovWindow', {width:750, height:550},false,'dialog',null);

Kindly give us a solution.

Regards.

Malar.
report abuse
vote down
vote up
Votes: +0
About pageContext
written by Radhika , September 11, 2009
Hi,

I got the same error mentioned by chenlin on 28th April 2008. He said he got the solution but its not mentioned here. Could you please tell me the solution?

Regards,
Radhika.
report abuse
vote down
vote up
Votes: +0
About pageContext
written by Radhika , September 11, 2009
The error is

Error(68,21): method setForwardURL(java.lang.String, null, byte, null, java.util.HashMap, boolean, java.lang.String, byte) not found in interface oracle.apps.fnd.framework.webui.OAPageContext
report abuse
vote down
vote up
Votes: +0
running standard oracle customer online page in jdev
written by Ramya , September 18, 2009
Hi Anil,

I downloaded all the files from Server.I am able to run the page in Jdev. The page which I currently run has a Drop down list which has a PPR event.So on selecting values in the drop down am able to get the respective attributes below. But whenever I select a particular value I am getting the below mentioned error. for the remaining values It is working fine.



oracle.apps.fnd.framework.OAException: oracle.jbo.JboException: JBO-29000: Unexpected exception caught: java.lang.NoSuchMethodError, msg=oracle.apps.fnd.framework.server.OAViewDef.addPersistentAttrDef(Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;ZBLjava/lang/Stringsmilies/wink.gifV



Please do help me resolving the issue.



Thanks
Ramya
report abuse
vote down
vote up
Votes: +1
doubt in oaf
written by Lakshminarayna , September 22, 2009
Hi,

i have created external lov but my requiremnt is user entered free text in lov.
please help me
report abuse
vote down
vote up
Votes: +0
Iexpenses report notification customization
written by anithan , November 05, 2009
Hi Anil,

I am doing Internet Expenses report notification customization in that I have to add each and every field name has to be with English and Chinese languages. Some profile developed to capture the Chinese characters. Can I call the profile in the prompt of the field? Or any other way is there Please give reply it is urgent requirement.
Thanks in advance

Regards,
Anitha.


report abuse
vote down
vote up
Votes: +0
Controller Extensions
written by Lakshminarayana , January 12, 2010
Hi Anil,

I extended CO. when i click on personalization page page layout Region pencil icon is not visible. how to do the personalization particular CO


Regards,
Lakshminarayana
report abuse
vote down
vote up
Votes: -1
Problem with DFF personalization
written by prashanthreddy , March 15, 2010
Hi Anil,

I have created a DFF item in a page. But i am facing a wiered problem. I am mentioning the steps that i have used to create the item and problem i faced at subsequent steps.

Here are the steps i followed
1)Create “Flex” Item at Location Level in the “Other” section on the Hire and Rehire: Person Details page (Hire & Rehire responsibility)

2)Return to Application and check that the field is being displayed correctly:

3)Cancel the Hire & Rehire transaction.
Begin a new Hire & Rehire transaction
Enter Basic Details
Continue to the next page (Rehire: Person Details)
Note that the field is NOT displayed

4)If I were to click “Personalize Page”, then do nothing and click “Return to Application”, the field is then displayed


Please help me out in solving this issues.

Thanks
Prashanth
report abuse
vote down
vote up
Votes: +0
...
written by andolsi , March 25, 2010
hi,
i got the some error like Radhika, and i found the solution, you have to import com.sun.java.util.collections.HashMap not java.utili.HashMap.

thanks
report abuse
vote down
vote up
Votes: +0
How to build Master-Detail screen in OA Framework - Part2 is not available
written by Harishnunna , April 08, 2010
Hi Anil,

Can you please give me the link for How to build Master-Detail screen in OA Framework - Part2 and also other parts in this topic.

Thanks,
Harish.
report abuse
vote down
vote up
Votes: +0
great stuff
written by Santo , April 11, 2010
Hi Anil
Great job
It is very helpful
report abuse
vote down
vote up
Votes: +0
How deploy the custome page in to apps instance
written by Raghunandan , April 15, 2010
I would appreciate ur work over here. This is very very use ful site for apps consultants. I'm new to OAF. Can u please provide me the step to be followed to deplooy
tha custom page into the apps instance. I need the step by step procedure.

Thanks in advance.......
Raghu
report abuse
vote down
vote up
Votes: +0
LOV in LOV in OA Framework
written by Sreeram Vaskuri , May 28, 2010
Hi Anil

I have one busniness requirement like LOV inside few more Serach fileds required like inside LOV region 1 LOV 2. Dropdown 3. Normal input field and TAb out should be work when enter any value in main inputlov.Could you please provide the solution on this.This is very urgent for my client business.

Thanks
Sreeram Vaskuri
report abuse
vote down
vote up
Votes: +0
Auto-Query on Page Load
written by Jaime McLamb , June 10, 2010
Hi Anil,

I have taken several of your training courses on JDeveloper and they are awesome! Thank you so much for putting them together and sharing them with everyone! I am new to JDeveloper and I am using JDeveloper 10g. I have a requirement to create a new tab on the SSHR Employee Self Service - Employee History View Page. I want to create a custom page in JDeveloper and create a new tab on the seeded page that links to the new custom page - I am hoping this is going to work. I have created a VO based on a custom query that I wrote to obtain the bonus information for the person logged into Oracle Apps. I created the VO with that query using View Attributes that I defined to hold the fields from my custom query, created an AM based on that VO, and I created a PG based on the AM. The issue that I am having is that I do not want to have to search to obtain the data on page load. I want the query to automatically execute on page load. Right now, no results are being returned when the page loads. I have to click on Go to execute a blind query to obtain the results. Do you know of a setting that will allow the results to be automatically queries on page load in 10g?

Thank you so much for your time!

Jaime
report abuse
vote down
vote up
Votes: +0
...
written by Anil Passi- , June 10, 2010
You can create a controller for your custom region. In processRequest, use oapagecontext.getEmployeeId() to fetch the current logged in person_id
Using that, you can dynamically set the where clause of view object and achieve auto query for that person that has logged in
report abuse
vote down
vote up
Votes: +0
Adding a subtab to a seeded OA Framework page
written by Jaime McLamb , June 22, 2010
Anil,

Thank you so much for your help! The Auto-Query is working great now!!! I am currently trying to embed the custom Region into a new Sub-Tab on the Employee Self Service - History Views Page. Unfortunately, the new subtab is not showing up. I completed the following steps.

1. Created sasEmpBonusHistoryVO, sasEmpBonusHistoryAM, sasEmpBonusHistoryRN, and sasEmpBonusHistoryCO in JDeveloper. The Region Type is stackLayout.
2. Deployed all files to the proper $JAVA_TOP webui and server directories
3. Imported sasEmpBonusHistoryRN into the database
4. Added the following site level customization to the oracleappsperselfservicemgrviewswebuiEmployeeVie wsPG and imported the change into the database afterwards :





5. To enable the tab and link on the page, I added the following function level customization to the oracleappsperselfservicemgrviewswebuiEmployeeVie wsPG and imported the change into the database afterwards :









6. Cleared all cache, logged out and back in, but the tab is not showing up. Actually, the personalization link in the upper right hand corner of the History Views Page (EmployeeViewsPG) can no longer be clicked either.

Just as a test, I removed the site and function level customizations, so that the personalization link would work again and I added the region to the main part of the EmployeeViewsPG (not within a tab) using personalization - item style of Flexible Layout and Flexible Content extending to the /sas/oracle/apps/per/selfservice/mgrviews/webui/sasEmpBonusHistoryRN per the "OA Framework Screen Extension by Embedding a Custom Page" training video you created and it worked great when adding it to the main part of the page using Flexible Layout. Unfortunately, the requirement is that the Region has to be part of a brand new subtab for Bonus information instead.

Do you know what I may be doing wrong that is preventing this sub tab from displaying on the SSHR Employee Self Service History Page in steps 1-6 above?

Thank you again for all of your help!

Jaime
report abuse
vote down
vote up
Votes: +0
Adding a subtab to a seeded OA Framework page
written by Jaime McLamb , June 23, 2010
Hi Anil,

Please ignore my previous comment, I figured it out last night smilies/smiley.gif

I was able to get this working by adding a new function from System Adminstrator responsibility > Application > Function and adding that new function to the menu (System Adminstrator responsibility > Application > Menu) used by the Employee - History Views Page! All is working perfectly now!

Just in case anyone needs this information for a similar task, I am going to attempt to repaste the tags that were filtered out in yesterday's request in #'s 4 and 5 :

4. Attempting to repost tags for step 4 from previous post: ' '

5. Attempting to repost tags for step 5 from previous post: ' '

If the tags still do not make it, they are also posted in forum : http://forums.oracle.com/forum...0&tstart=0

Thanks again for your help with this!

Jaime
report abuse
vote down
vote up
Votes: +0
Displaying Master Detail Records differently
written by Yasser , July 19, 2010
Hi Anil,

I was wondering if it would be possible to display the header record immediately followed by its child records ?

So for example:

Expense_Report_headers:

Report_Header_ID, Total
100, 150
101, 600


Expense_Report_Lines:
Report_Header_ID, Line_ID, type, amount
100, 1, airfare, 100
100, 2, taxi, 50
101,1, lodging 500
101,2, meals, 100

And we'd like to see if the OAF page can display :

Report_Header_ID, Total
100, 150
Line_ID, type, amount
1, airfare, 100
2, taxi, 50
Report_Header_ID, Total
101, 600
Line_ID, type, amount
1, lodging 500
2, meals, 100

We are currently using Oracle EBS 11.5.10 RUP 7

Thanks again for all your help !
report abuse
vote down
vote up
Votes: +0
Write comment
quote
bold
italicize
underline
strike
url
image
quote
quote
smile
wink
laugh
grin
angry
sad
shocked
cool
tongue
kiss
cry
smaller | bigger

security image
Write the displayed characters


busy
 

Related Items

Search apps2fusion